Description | plasma serine protease inhibitor |
---|---|
Organism | Homo sapiens |
Chain | E |
Length | 329 |
Binding Area (Å2) | 1963.48 |
Molecular Weight | 36929.84 |
Aromaticity | 0.10 |
Instability | 42.82 |
Isoelectric Point | 8.47 |
Sequence | RRDFTFDLYRALASAAPSQNIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFR |
Description | plasma serine protease inhibitor |
---|---|
Organism | Homo sapiens |
Chain | F |
Length | 28 |
Binding Area (Å2) | 2419.69 |
Hydrophobic (% a.a.) |
|
Molecular Weight | 3348.96 |
Aromaticity | 0.14 |
Instability | 45.26 |
Isoelectric Point | 11.71 |
Sequence | SQRLVFNRPFLMFIVDNNILFLGKVNRP |
Is the complex classified in the same cluster?
Complex |
Sequence cluster (S486) |
Contact cluster (C18) |
Interface cluster (I322) |
---|---|---|---|
3dy0-B-A | |||
2xn6-B-A | |||
6hgi-B-A | |||
2xn7-B-A | |||
6hgj-B-A | |||
3caa-B-A | |||
6hgk-B-A | |||
6hgl-B-A | |||
3f02-C-A | |||
6hgm-B-A | |||
3f02-D-B | |||
6hgn-B-A | |||
3ndd-B-A | |||
5om5-B-A | |||
1as4-B-A | |||
5om6-B-A | |||
1hle-B-A | |||
5om6-D-C | |||
2h4p-B-A | |||
5om7-B-A | |||
2h4q-B-A | |||
5om8-B-A | |||
2riv-B-A | |||
6f4u-D-A | |||
2riw-B-A | |||
6hgd-B-A | |||
2xn3-B-A | |||
6hgg-B-A | |||
2xn5-B-A | |||
6hgh-B-A |